PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00034.1.g05100.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 571aa    MW: 63577.6 Da    PI: 4.8604
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00034.1.g05100.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4232.5e-1292025712374
                            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80 
                                     ++lL++cA  +s+ ++ +aqa++++l++++s +gdp qR+aay++e+Laar++ s++++ykal++++ +   +  +l+a
  Zjn_sc00034.1.g05100.1.am.mkhc 202 KQLLFDCAMSLSEYNTDEAQAIITELRQMVSIQGDPSQRIAAYLVEGLAARIVASGKGIYKALTCKDPP---TLYQLSA 277
                                     589*****************************************************************9...89999** PP

                            GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skee 157
                                     +++++e++P++++++++aN aIlea +geervHiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      
  Zjn_sc00034.1.g05100.1.am.mkhc 278 MQILFEICPCFRLGFMAANYAILEACKGEERVHIIDFDINQGSQYITLIQFLKNNANKPRHLRITGVDDPETVqrPIGG 356
                                     ***********************************************************************99878899 PP

                            GRAS 158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsP 236
                                     l+ +g+rL+k+Ae +gv+fef++ v  ++ d+++ +L+++pgE l++n+++qlh+l+desvs+ +erd++L++vk+l+P
  Zjn_sc00034.1.g05100.1.am.mkhc 357 LRVIGQRLEKLAEDCGVSFEFRA-VGANIGDVTPAMLDCRPGEGLVINFAFQLHHLPDESVSIMNERDQLLRMVKGLQP 434
                                     ***********************.799**************************************************** PP

                            GRAS 237 kvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                                     k+v++veq+a++n+++Fl+rf e  +yy+alfdsl+a+lpres +r++vEr++l+reivn++aceg +r+er e ++kW
  Zjn_sc00034.1.g05100.1.am.mkhc 435 KLVTLVEQDANTNTAPFLTRFREVYDYYAALFDSLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKW 513
                                     ******************************************************************************* PP

                            GRAS 316 rerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                     r+r+++aGFkp p+++++ + +++ll+ + ++ y+ ee++g l +gW +++L++ SaW+
  Zjn_sc00034.1.g05100.1.am.mkhc 514 RARMTMAGFKPCPFNSNVISGIRSLLKSYCDR-YKFEEHHGGLHFGWGEKSLIVSSAWQ 571
                                     ******************************66.*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.7175552IPR005202Transcription factor GRAS
PfamPF035148.8E-127202571IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MSFVRRVDPS TAYSDNLYVH KFASPSSNFA PRRFGSDTQL FRYGPEPYNA EYGHMSFTGA  60
PSAEFQNSLC SQQASLTAYR ITADGLSTTV EDIQSNSCSD VAKNSPVLSN VSQQNSQSAS  120
DSQSSGIEVE FDDDEMRLKL QELEHALLGD GDDILFEISQ TGSINDEWAD PMKNVLTPTS  180
PKDSESSVSC AVSNNRATRT PKQLLFDCAM SLSEYNTDEA QAIITELRQM VSIQGDPSQR  240
IAAYLVEGLA ARIVASGKGI YKALTCKDPP TLYQLSAMQI LFEICPCFRL GFMAANYAIL  300
EACKGEERVH IIDFDINQGS QYITLIQFLK NNANKPRHLR ITGVDDPETV QRPIGGLRVI  360
GQRLEKLAED CGVSFEFRAV GANIGDVTPA MLDCRPGEGL VINFAFQLHH LPDESVSIMN  420
ERDQLLRMVK GLQPKLVTLV EQDANTNTAP FLTRFREVYD YYAALFDSLD ATLPRESPDR  480
MNVERQCLAR EIVNILACEG PDRVERYEVA GKWRARMTMA GFKPCPFNSN VISGIRSLLK  540
SYCDRYKFEE HHGGLHFGWG EKSLIVSSAW Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5422057122375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5347040.0EF534704.1 Aeluropus littoralis scarecrow gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970786.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA5HJS40.0A5HJS4_9POAL; Scarecrow
STRINGSi000832m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1